Skip to the content

Kansas State University

 

LOCUS       AY318786                1554 bp    DNA     linear   INV 26-SEP-2003
DEFINITION  Mayetiola destructor clone 12a12 salivary secreted protein gene,
            complete cds.
ACCESSION   AY318786
VERSION     AY318786
KEYWORDS    .
SOURCE      Mayetiola destructor (Hessian fly)
  ORGANISM  Mayetiola destructor
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea;
            Cecidomyiidae; Mayetiola.
REFERENCE   1  (bases 1 to 1554)
  AUTHORS   Liu,X., Fellers,J.P., Wilde,G.E. Stuart,J.J., and Chen,M.-S.
  TITLE     Characterization of two genes expressed in the salivary glands of
     the Hessian fly, Mayetiola destructor (Say)
  JOURNAL   INSECT BIOCHEMISTRY AND MOLECULAR BIOLOGY, IN PRESS
REFERENCE   2  (bases 1 to 1554)
  AUTHORS   Chen,M.-S. and Fellers,J.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUN-2003) Plant Science and Entomology Research unit,
            USDA-ARS, 1515 College Avenue, Manhattan, KS 66502, USA
FEATURES             Location/Qualifiers
     source          1..1554
                     /organism="Mayetiola destructor"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:39758"
                     /clone="12a12"
                     /note="biotype: gp"
     CAAT_signal     58..63
     TATA_signal     115..119
     mRNA            join(147..268,333..380,484..909,1035..1302)
                     /product="salivary secreted protein"
     CDS             join(224..268,333..380,484..909,1035..1220)
                     /codon_start=1
                     /evidence=not_experimental
                     /product="salivary secreted protein"
                     /protein_id="AAQ88246"
                     /translation="MKIFFWLLVILVVVQTLMAMPDEGESEITEEEPLLRTASTLTRF
                     DSTISELAPNSPDLARLESAVSEVSRSFSELAKTMPNSPGLSRFESTVSELARTTSAL
                     VRSSSTRSGTTPAETSEPTPQTSSECACKGLKPLSAGKKLCICDACFRARNERGIPHP
                     DSDNGADTTGEASTNAVEEHTCDCRKKKKLRNLTSTEMSCKCIGCRIKRAKRGLQRVK
                     KADENEIEEEIEKKNN"
     polyA_signal    1231..1236
BASE COUNT      515 a    256 c    292 g    491 t
ORIGIN     
        1 gatctgaagt ttaaatcatt cgaaaaaaaa ttcggttgac aacaaaactt gttttctcca
       61 attcgaaatt tctcattatc ttcagtctat tctcttaatt tcaattccat atagtataaa
      121 agccgttagg atattgtatt ggagtcagtg aacagtgaac agtgaacaat taaactttct
      181 aacttgaaca gctaaaaaaa gcagaaaata aaactctttc aaaatgaaga tatttttctg
      241 gttacttgta attttggttg tcgtgcaggt aaaaaatttc cgaatttttt aaaaatataa
      301 ttcatttatt tatttgggtc ctttccattc agacacttat ggctatgcct gatgaaggcg
      361 aaagtgaaat aaccgaagag gtaaaaaaga aaattatcaa aataataaat attatagtcg
      421 attgatttga atattttttt ctcattctat aaaattgtac ttaccgtttt atggattctt
      481 caggagccgc ttttgaggac agcgtctaca ttgactcggt ttgattcgac tatttctgaa
      541 ttggctccga attcaccaga cttggctcgg ttggagtcgg ctgtgtctga ggttagtcgg
      601 agtttttctg aattggctaa gactatgccg aattcgccag gtctgagtcg gttcgagtcg
      661 actgtgtctg agttggctcg gactacgtct gcattggttc ggtcttcctc gactcgctct
      721 gggacgactc cggctgagac aagtgaaccg acgccccaaa caagtagtga atgtgcatgt
      781 aaaggattga agccgctcag cgctggtaaa aagttatgca tttgtgatgc ttgctttcgt
      841 gcaaggaatg aacgaggcat tccccatcca gattcggata atggtgcgga tacaaccgga
      901 gaggcatcgg tatgtaataa tgcaaataaa gaaacttatc gaaataatta aaataaatat
      961 cataatcaat aagttttagt attttttcca ttcaattcta tgtattaatc gtttcatggc
     1021 ctcttcaatt acagacgaat gcagtggagg aacatacctg tgactgtcgc aagaagaaga
     1081 aacttcgaaa cctcacatcg acagaaatga gctgcaaatg tattggatgc cgtattaaaa
     1141 gggcaaaacg aggccttcaa cgagttaaga aagcagatga gaatgaaatt gaagaagaaa
     1201 tcgaaaaaaa aaataattaa atcgttgatg aataaaaatg atatcattcc ataaactatg
     1261 taaaattgtt aattctaatt aaaataacaa tttcataatg taattaaaaa atttgtttca
     1321 attttcaaat gcttttgcgt tatccaacct cttagcttac agcaccctca aaatgttgag
     1381 tggtgataga attgtgaatc aaactttcta atccggttct attctcaata gcagtgagct
     1441 ccccataggg aatcagattg aagaatttat gcgatggagg aacgcataat ccaatattag
     1501 attcaaataa ataaaatgaa atgtacattc tttctttctt ttcttttcat taat


LOCUS       AY318787                 862 bp    mRNA    linear   INV 26-SEP-2003
DEFINITION  Mayetiola destructor clone 10d2 salivary secreted protein mRNA,
            complete cds.
ACCESSION   AY318787
VERSION     AY318787
KEYWORDS    .
SOURCE      Mayetiola destructor (Hessian fly)
  ORGANISM  Mayetiola destructor
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea;
            Cecidomyiidae; Mayetiola.
REFERENCE   1  (bases 1 to 862)
  AUTHORS   Liu,X., Fellers,J.P., Wilde,G.E. Stuart,J.J., and Chen,M.-S.
  TITLE     Characterization of two genes expressed in the salivary glands of
     the Hessian fly, Mayetiola destructor (Say)
  JOURNAL   INSECT BIOCHEMISTRY AND MOLECULAR BIOLOGY, IN PRESS
REFERENCE   2  (bases 1 to 862)
  AUTHORS   Chen,M.-S. and Fellers,J.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUN-2003) Plant Science and Entomology Research unit,
            USDA-ARS, 1515 College Avenue, Manhattan, KS 66502, USA
FEATURES             Location/Qualifiers
     source          1..862
                     /organism="Mayetiola destructor"
                     /mol_type="mRNA"
                     /db_xref="taxon:39758"
                     /clone="10d2"
                     /note="biotype: gp"
     CDS             78..776
                     /codon_start=1
                     /evidence=not_experimental
                     /product="salivary secreted protein"
                     /protein_id="AAQ88247"
                     /translation="MKIFFWLLVILVVVQTLMAMPDEGESEITEEEPLLRTASTLTRF
                     DSTISELAPNSPDLARLESAVSEVSRSFSELAKTMPNSPGLSRFESTVSELARTTSAL
                     VRSSSTRSGTTPAETSEPTPQTSSECACKGLKPLSAGKKLCICDACFRARNERGIPHP
                     DSDNGADTTGEASTNAVEEHPCDCRKKKKLRTLTSTEMSCKCIGCRIKRAKRGLQRVK
                     KADENEIEEEIEKK"
BASE COUNT      271 a    159 c    207 g    225 t
ORIGIN     
        1 agtgaacagt gaacagtgaa caattaaact ttctaacttg aacagctaaa aaaagcagaa
       61 aataaaactc tttcaaaatg aagatatttt tctggttact tgtaattttg gttgtcgtgc
      121 agacacttat ggctatgcct gatgaaggcg aaagtgaaat aaccgaagag gagccgcttt
      181 tgaggacagc gtctacattg actcggtttg attcgactat ttctgaattg gctccgaatt
      241 caccagactt ggctcggttg gagtcggctg tgtctgaggt tagtcggagt ttttctgaat
      301 tggctaagac tatgccgaat tcgccaggtc tgagtcggtt cgagtcgact gtgtctgagt
      361 tggctcggac tacgtctgca ttggttcggt cttcctcgac tcgctctggg acgactccgg
      421 ctgagacaag tgaaccgacg ccccaaacaa gtagtgaatg tgcatgtaaa ggattgaagc
      481 cgctcagcgc tggtaaaaag ttatgcattt gtgatgcttg ctttcgtgca aggaatgaac
      541 gaggcattcc ccatccagat tcggataatg gtgcggatac aaccggagag gcatcgacga
      601 atgcagtgga ggaacatccc tgtgactgtc gcaagaagaa gaaacttcga accctcacat
      661 cgacagaaat gagctgcaaa tgtattggat gccgtattaa aagggcaaaa cgaggccttc
      721 aacgagttaa gaaagcagat gagaatgaaa ttgaagaaga aatcgaaaaa aaataattaa
      781 atcgttgatg aataaaaatg atatcattcc ataaactatg taaaattgtt aattctaatt
      841 aaaataacaa tttcataatg cc


LOCUS       AY318788                 862 bp    mRNA    linear   INV 26-SEP-2003
DEFINITION  Mayetiola destructor clone 15f10 salivary secreted protein mRNA,
            complete cds.
ACCESSION   AY318788
VERSION     AY318788
KEYWORDS    .
SOURCE      Mayetiola destructor (Hessian fly)
  ORGANISM  Mayetiola destructor
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea;
            Cecidomyiidae; Mayetiola.
REFERENCE   1  (bases 1 to 862)
  AUTHORS   Liu,X., Fellers,J.P., Wilde,G.E. Stuart,J.J., and Chen,M.-S.
  TITLE     Characterization of two genes expressed in the salivary glands of
     the Hessian fly, Mayetiola destructor (Say)
  JOURNAL   INSECT BIOCHEMISTRY AND MOLECULAR BIOLOGY, IN PRESS
REFERENCE   2  (bases 1 to 862)
  AUTHORS   Chen,M.-S. and Fellers,J.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUN-2003) Plant Science and Entomology Research unit,
            USDA-ARS, 1515 College Avenue, Manhattan, KS 66502, USA
FEATURES             Location/Qualifiers
     source          1..862
                     /organism="Mayetiola destructor"
                     /mol_type="mRNA"
                     /db_xref="taxon:39758"
                     /clone="15f10"
                     /note="biotype: gp"
     CDS             78..776
                     /codon_start=1
                     /evidence=not_experimental
                     /product="salivary secreted protein"
                     /protein_id="AAQ88248"
                     /translation="MKIFFWLLVILVVVQTLMAMPDEGESEITEEEPLLRTTSTLTRF
                     DSTISELAPNSPDLARLESAVSEVSRSFSELAKTMPNSPGLSRFESTVSELARTTSAL
                     VRSSSTRSGATPAETSEPTPQTSSECACKGLKPLSAGKKLCICDACFRARNERGIPHP
                     DSDNGADTTGEASTNAVEEHTCDCRKKKKLRNLTSTEMSCKCIGCRIKRAKRGLQRVK
                     KADENEIEEEIEKK"
BASE COUNT      272 a    156 c    207 g    227 t
ORIGIN     
        1 agtgaacagt gaacagtgaa cagttaaact ttctaacttg aacagttaac aaaagcagaa
       61 aattaaactc tttcaaaatg aagatatttt tctggttact tgtaattttg gttgtcgtgc
      121 agacacttat ggctatgcct gatgaaggcg aaagtgaaat aaccgaagag gagccgcttt
      181 tgaggacaac atctacattg actcggtttg attcgactat ttctgaattg gctccgaatt
      241 caccagactt ggctcggttg gagtcggctg tgtctgaggt tagtcggagt ttttctgaat
      301 tggctaagac tatgccgaat tcgccaggtc tgagtcggtt cgagtcgact gtgtctgagt
      361 tggctcggac tacgtctgca ttggttcggt cttcctcgac tcgctctggg gcgactccgg
      421 ctgaaacaag tgaaccgacg ccccaaacaa gtagtgaatg tgcgtgtaaa ggattgaagc
      481 cgctcagcgc tggtaaaaag ttatgcattt gtgatgcttg ctttcgtgca aggaatgaac
      541 gaggcattcc acatccagat tcggataatg gtgcggatac aaccggagag gcatcgacga
      601 atgcagtgga ggaacatacc tgtgactgtc gcaagaaaaa gaaacttcga aacctcacat
      661 cgacagaaat gagctgcaag tgtattggat gccgtattaa aagggcaaaa cgaggccttc
      721 aacgagttaa gaaagcagat gagaatgaaa ttgaagaaga aatcgaaaaa aaataattaa
      781 atcgttgatg aataaaaatg atatcattcc ataaactatg taaaattgtt aattctaatt
      841 aaaataacaa tttcataatg cc


LOCUS       AY318789                 315 bp    mRNA    linear   INV 26-SEP-2003
DEFINITION  Mayetiola destructor clone 10a10 salivary secreted protein mRNA,
            complete cds.
ACCESSION   AY318789
VERSION     AY318789
KEYWORDS    .
SOURCE      Mayetiola destructor (Hessian fly)
  ORGANISM  Mayetiola destructor
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea;
            Cecidomyiidae; Mayetiola.
REFERENCE   1  (bases 1 to 315)
  AUTHORS   Liu,X., Fellers,J.P., Wilde,G.E. Stuart,J.J., and Chen,M.-S.
  TITLE     Characterization of two genes expressed in the salivary glands of
     the Hessian fly, Mayetiola destructor (Say)
  JOURNAL   INSECT BIOCHEMISTRY AND MOLECULAR BIOLOGY, IN PRESS
REFERENCE   2  (bases 1 to 315)
  AUTHORS   Chen,M.-S. and Fellers,J.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUN-2003) Plant Science and Entomology Research unit,
            USDA-ARS, 1515 College Avenue, Manhattan, KS 66502, USA
FEATURES             Location/Qualifiers
     source          1..315
                     /organism="Mayetiola destructor"
                     /mol_type="mRNA"
                     /db_xref="taxon:39758"
                     /clone="10a10"
                     /note="biotype: gp"
     CDS             17..256
                     /codon_start=1
                     /evidence=not_experimental
                     /product="salivary secreted protein"
                     /protein_id="AAQ88249"
                     /translation="MQKTTILVIFAVVFFASPFFASANQNAEEIGAKILKNVRVREWS
                     TFDPKEPKDTPAKILYRPSNRNWDNFEKSNSEKKK"
BASE COUNT      123 a     58 c     51 g     83 t
ORIGIN     
        1 tagtcaactt tgtacaatgc agaagacaac aattttagta attttcgctg tagttttctt
       61 tgcgtcaccc ttttttgcat ctgcaaacca aaacgcagaa gagatcggtg caaagatcct
      121 caagaacgta cgcgtaagag aatggtcaac ttttgatcct aaagagccca aagatacacc
      181 cgcaaaaatt ctttatcgtc cctcaaatag aaattgggat aactttgaaa aatccaactc
      241 agaaaagaag aagtgaaaca atgaatatct attttattct ataaaaaaaa aataaaggaa
      301 aaggtctaaa tcagc


LOCUS       AY318790                 315 bp    mRNA    linear   INV 26-SEP-2003
DEFINITION  Mayetiola destructor clone 9a2 salivary secreted protein mRNA,
            complete cds.
ACCESSION   AY318790
VERSION     AY318790
KEYWORDS    .
SOURCE      Mayetiola destructor (Hessian fly)
  ORGANISM  Mayetiola destructor
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea;
            Cecidomyiidae; Mayetiola.
REFERENCE   1  (bases 1 to 315)
  AUTHORS   Liu,X., Fellers,J.P., Wilde,G.E. Stuart,J.J., and Chen,M.-S.
  TITLE     Characterization of two genes expressed in the salivary glands of
     the Hessian fly, Mayetiola destructor (Say)
  JOURNAL   INSECT BIOCHEMISTRY AND MOLECULAR BIOLOGY, IN PRESS
REFERENCE   2  (bases 1 to 315)
  AUTHORS   Chen,M.-S. and Fellers,J.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUN-2003) Plant Science and Entomology Research unit,
            USDA-ARS, 1515 College Avenue, Manhattan, KS 66502, USA
FEATURES             Location/Qualifiers
     source          1..315
                     /organism="Mayetiola destructor"
                     /mol_type="mRNA"
                     /db_xref="taxon:39758"
                     /clone="9a2"
                     /note="biotype: gp"
     CDS             17..256
                     /codon_start=1
                     /evidence=not_experimental
                     /product="salivary secreted protein"
                     /protein_id="AAQ88250"
                     /translation="MQKTTILVIFAVVFFASAFFASANQNAEEIGAKILKNVRVREWS
                     TFDPKEPKDTAAKILYRASNRNWDNFEKSNSEKKK"
BASE COUNT      124 a     55 c     55 g     81 t
ORIGIN     
        1 tagtcaactt tgtacaatgc agaagacaac aattttagta attttcgcag tagttttctt
       61 tgcgtcagcc ttttttgcat ctgcaaacca aaacgcagaa gagatcggtg caaagatcct
      121 caagaacgta cgcgtaagag aatggtcaac ttttgatcct aaagagccca aagatacagc
      181 cgcaaaaatt ctttatcgtg cctcaaatag aaattgggat aactttgaaa aatccaactc
      241 agaaaagaag aagtgaaaca atgaatatcg attttattct ataaaaaaaa aataaaggaa
      301 aaggtctaaa tcagc


LOCUS       AY318791                 313 bp    mRNA    linear   INV 26-SEP-2003
DEFINITION  Mayetiola destructor clone 15f8 salivary secreted protein mRNA,
            complete cds.
ACCESSION   AY318791
VERSION     AY318791
KEYWORDS    .
SOURCE      Mayetiola destructor (Hessian fly)
  ORGANISM  Mayetiola destructor
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea;
            Cecidomyiidae; Mayetiola.
REFERENCE   1  (bases 1 to 313)
  AUTHORS   Liu,X., Fellers,J.P., Wilde,G.E. Stuart,J.J., and Chen,M.-S.
  TITLE     Characterization of two genes expressed in the salivary glands of
     the Hessian fly, Mayetiola destructor (Say)
  JOURNAL   INSECT BIOCHEMISTRY AND MOLECULAR BIOLOGY, IN PRESS
REFERENCE   2  (bases 1 to 313)
  AUTHORS   Chen,M.-S. and Fellers,J.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUN-2003) Plant Science and Entomology Research unit,
            USDA-ARS, 1515 College Avenue, Manhattan, KS 66502, USA
FEATURES             Location/Qualifiers
     source          1..313
                     /organism="Mayetiola destructor"
                     /mol_type="mRNA"
                     /db_xref="taxon:39758"
                     /clone="15f8"
                     /note="biotype: gp"
     CDS             17..256
                     /codon_start=1
                     /evidence=not_experimental
                     /product="salivary secreted protein"
                     /protein_id="AAQ88251"
                     /translation="MQKTTILVIFAVVFFASAFFASANQNAEEIGAKILKNVRGREWS
                     TFDPKEPKDTAAKILYRASNRNWDNFEKSNSEKKK"
BASE COUNT      122 a     50 c     55 g     86 t
ORIGIN     
        1 tagtcaactt tgtacaatgc agaagacaac aattttagta atttttgctg tagttttctt
       61 tgcgtcagcc ttttttgcat ctgcaaacca aaatgcagaa gagatcggtg caaaaattct
      121 taagaacgta cgcggaagag aatggtcaac ttttgatcct aaagagccca aagatacagc
      181 cgcaaaaatt ctttatcgtg cctcaaatag aaattgggat aactttgaaa aatccaactc
      241 agaaaagaag aagtgaaaca atgaatatcg attttattct ataaaaaaaa taaaggaaaa
      301 ggtctaaatt agc


LOCUS       AY318792                 667 bp    DNA     linear   INV 26-SEP-2003
DEFINITION  Mayetiola destructor clone 2a6 salivary secreted protein gene,
            complete cds.
ACCESSION   AY318792
VERSION     AY318792
KEYWORDS    .
SOURCE      Mayetiola destructor (Hessian fly)
  ORGANISM  Mayetiola destructor
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea;
            Cecidomyiidae; Mayetiola.
REFERENCE   1  (bases 1 to 667)
  AUTHORS   Liu,X., Fellers,J.P., Wilde,G.E., Stuart,J.J., and Chen,M.-S.
TITLE     Characterization of two genes expressed in the salivary glands of the
            Hessian fly, Mayetiola destructor (Say)
  JOURNAL   INSECT BIOCHEMISTRY AND MOLECULAR BIOLOGY, IN PRESS
REFERENCE   2  (bases 1 to 667)
  AUTHORS   Chen,M.-S. and Fellers,J.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUN-2003) Plant Science and Entomology Research unit,
            USDA-ARS, 1515 College Avenue, Manhattan, KS 66502, USA
FEATURES             Location/Qualifiers
     source          1..667
                     /organism="Mayetiola destructor"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:39758"
                     /clone="2a6"
                     /note="biotype: gp"
     TATA_signal     34..38
     CAAT_signal     52..56
     mRNA            join(66..103,192..471)
                     /product="salivary secreted protein"
     CDS             join(82..103,192..409)
                     /codon_start=1
                     /evidence=not_experimental
                     /product="salivary secreted protein"
                     /protein_id="AAQ88252"
                     /translation="MQKTTILVIFAVVFFASAFFASANQNAEEIGAKILKNVRLREWV
                     TFDPKEPKDTAAKILYRASNRNWDNFEKSNSEKKK"
     polyA_signal    444..448
BASE COUNT      228 a    122 c    116 g    201 t
ORIGIN     
        1 gatcatttac tcaaatttat ggatgacttt cactataaaa gattgtcaat gaattgataa
       61 agctatagtc aactttgtac aatgcagaag acaacaattt taggtaagaa tttgggggtt
      121 ctgggctcca ttagccattc cataaattat caaaataata acagtttgtt tttcttctct
      181 cgtttgaaca gtaattttcg ctgtagtttt ctttgcgtca gccttttttg catctgcaaa
      241 ccaaaacgca gaagagatcg gtgcaaagat cctcaagaac gtacgcctaa gagaatgggt
      301 aacttttgat cctaaagagc ccaaagatac agccgcaaaa attctttatc gtgcctcaaa
      361 tagaaattgg gataactttg aaaaatccaa ctcagaaaag aagaagtgaa acaatgaata
      421 tcgattttat tctataaaaa aaaaataaag gaaaaggtct aaatcagcag aaattgatat
      481 gatgtgtttt tttccgactt ttggttagcc cttactgtgt aaaatttcaa cttggctcca
      541 aattgagatg agccacaacc tggcttttat cattccaaga gttccgattc accctattga
      601 cgtgccaaat tcgaaactga acggcaatca attgatttga tcctccagag tcgaactcag
      661 gcatcaa


LOCUS       AY318793                 625 bp    mRNA    linear   INV 26-SEP-2003
DEFINITION  Mayetiola destructor clone 8c1 salivary secreted protein mRNA,
            complete cds.
ACCESSION   AY318793
VERSION     AY318793
KEYWORDS    .
SOURCE      Mayetiola destructor (Hessian fly)
  ORGANISM  Mayetiola destructor
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea;
            Cecidomyiidae; Mayetiola.
REFERENCE   1  (bases 1 to 625)
  AUTHORS   Chen,M.-S., Fellers,J.P., Stuart,J.J., Reese,J.C., and Liu,X.
  TITLE     A group of cDNAs encoding secreted proteins from Hessian fly
            (Mayetiola destructor) salivary glands
  JOURNAL   INSECT MOLECULAR BIOLOGY, IN PRESS
REFERENCE   2  (bases 1 to 625)
  AUTHORS   Chen,M.-S. and Fellers,J.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUN-2003) Plant Science and Entomology Research unit,
            USDA-ARS, 1515 College Avenue, Manhattan, KS 66502, USA
FEATURES             Location/Qualifiers
     source          1..625
                     /organism="Mayetiola destructor"
                     /mol_type="mRNA"
                     /db_xref="taxon:39758"
                     /clone="8c1"
                     /note="biotype: gp"
     CDS             26..343
                     /codon_start=1
                     /evidence=not_experimental
                     /product="salivary secreted protein"
                     /protein_id="AAQ88253"
                     /translation="MKYSLAFLFVASTAFLMASAAPKRAAQQSAAGLPSAPRTEAQLL
                     NELRLAQNALEGLGRRVPDTDLPTEQEKLADAEQLRAARLRLARARAALNLPILDFDT
                     RRQ"
BASE COUNT      197 a    134 c    115 g    179 t
ORIGIN     
        1 tctagagaaa acaaactaaa ttaaaatgaa gtattcgtta gctttccttt tcgtagcttc
       61 tacagctttt ttgatggcca gcgctgcacc gaaacgcgct gctcagcaaa gcgctgcagg
      121 gttgccctct gctccacgaa ccgaagcaca gttgctcaat gaactgagac tggctcaaaa
      181 tgcactcgag ggacttggac gccgcgtacc ggataccgat ctacctacgg aacaggagaa
      241 attggcagat gctgaacagt tgcgcgctgc acgattgcgc cttgcccggg cacgcgctgc
      301 attgaatctc cctatattgg atttcgatac aagacgccaa taaaatattg tacttatata
      361 atagcggaaa agatattgaa cgcgccacta tgacgtcaaa aattgaagtt ttcttacatt
      421 ctttatttta tagccgtctt acaaatgcat tgatgttgta taatatcttc cgctaaaatt
      481 ggtataccca accgaaatat tcaataaaca ctcataaatt tatcacttac attcaatgta
      541 attatttttc ggaaaatata atacgaaatt gaattgttaa cttctgatat aaagaaaata
      601 aatatttttg aatgttcaca cacgc


LOCUS       AY318794                 562 bp    mRNA    linear   INV 26-SEP-2003
DEFINITION  Mayetiola destructor clone 9b10 salivary secreted protein mRNA,
            complete cds.
ACCESSION   AY318794
VERSION     AY318794
KEYWORDS    .
SOURCE      Mayetiola destructor (Hessian fly)
  ORGANISM  Mayetiola destructor
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea;
            Cecidomyiidae; Mayetiola.
REFERENCE   1  (bases 1 to 562)
  AUTHORS   Chen,M.-S., Fellers,J.P., Stuart,J.J., Reese,J.C., and Liu,X.
  TITLE     A family of cDNAs encoding secreted proteins from Hessian fly
            (Mayetiola destructor) salivary glands
  JOURNAL   INSECT MOLECULAR BIOLOGY, IN PRESS
REFERENCE   2  (bases 1 to 562)
  AUTHORS   Chen,M.-S. and Fellers,J.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUN-2003) Plant Science and Entomology Research unit,
            USDA-ARS, 1515 College Avenue, Manhattan, KS 66502, USA
FEATURES             Location/Qualifiers
     source          1..562
                     /organism="Mayetiola destructor"
                     /mol_type="mRNA"
                     /db_xref="taxon:39758"
                     /clone="9b10"
                     /note="biotype: gp"
     CDS             48..365
                     /codon_start=1
                     /evidence=not_experimental
                     /product="salivary secreted protein"
                     /protein_id="AAQ88254"
                     /translation="MKYSLAFLFVASTAFLMASAAPKRAAQQSAEGLPSAPRTEAQLL
                     NELRLAQNALEGLGRRVPDTDLPTEQEKLADAEQLRAARLRLARARAALNLPILDFDT
                     RRQ"
BASE COUNT      176 a    122 c    105 g    159 t
ORIGIN     
        1 atcagttttg aatgaactta gttctagaga aaacaaacta aattaaaatg aagtattcgt
       61 tagctttcct tttcgtagct tctacagctt ttttgatggc cagcgctgca ccgaaacgcg
      121 ctgctcagca aagcgctgaa gggttgccct ctgctccacg aaccgaagca cagttgctca
      181 atgaactgag actggctcaa aatgcactcg agggacttgg acgccgcgta ccggataccg
      241 atctacctac ggaacaggag aaattggcag atgctgaaca gttgcgcgct gcacgattgc
      301 gccttgcccg ggcacgcgct gcattgaatc tccctatatt ggatttcgat acaagacgcc
      361 aataaaatat tccgtcttac aaatgcattg atgttgtata atatcttccg ctaaaattgg
      421 tatacccaac cgaaatattc aataaacact cataaattta tcacttacat tcaatgtaat
      481 tatttttcgg aaaatataat acgaaattga attgttaact tctgatataa agaaaataaa
      541 tatttttgaa tgttcacaca ct


LOCUS       AY318795                 579 bp    mRNA    linear   INV 26-SEP-2003
DEFINITION  Mayetiola destructor clone 10d11 salivary secreted protein mRNA,
            complete cds.
ACCESSION   AY318795
VERSION     AY318795
KEYWORDS    .
SOURCE      Mayetiola destructor (Hessian fly)
  ORGANISM  Mayetiola destructor
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea;
            Cecidomyiidae; Mayetiola.
REFERENCE   1  (bases 1 to 579)
  AUTHORS   Chen,M.-S., Fellers,J.P., Stuart,J.J., Reese,J.C., and Liu,X.
  TITLE     A group of cDNAs encoding secreted proteins from Hessian fly
            (Mayetiola destructor) salivary glands
  JOURNAL   INSECT MOLECULAR BIOLOGY, IN PRESS
REFERENCE   2  (bases 1 to 579)
  AUTHORS   Chen,M.-S. and Fellers,J.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUN-2003) Plant Science and Entomology Research unit,
            USDA-ARS, 1515 College Avenue, Manhattan, KS 66502, USA
FEATURES             Location/Qualifiers
     source          1..579
                     /organism="Mayetiola destructor"
                     /mol_type="mRNA"
                     /db_xref="taxon:39758"
                     /clone="10d11"
                     /note="biotype: gp"
     CDS             26..343
                     /codon_start=1
                     /evidence=not_experimental
                     /product="salivary secreted protein"
                     /protein_id="AAQ88255"
                     /translation="MKYSLAFLFVASTAFLMASAAPKRAAQQSEEQLRSAPRTEAQLR
                     NELRLALNALEGLGRRVPDTDVPTVQERLADAEELRAARLRLARARAALNLPILDFDT
                     RRQ"
BASE COUNT      180 a    121 c    112 g    166 t
ORIGIN     
        1 tctaaagaaa acaaactaaa ttaaaatgaa gtattcgtta gctttccttt tcgtagcttc
       61 tacagctttt ttgatggcca gcgctgcacc gaaacgcgct gctcagcaaa gcgaagaaca
      121 gttgcgctct gctccgcgaa ccgaagcaca gttgcgcaat gaactgagac tggctttaaa
      181 tgcactcgag ggacttggac gccgcgtacc ggataccgat gtacctacgg tacaggagag
      241 attggcagat gctgaagagt tgcgcgctgc acgattgcgc cttgcccggg cacgcgctgc
      301 attgaatctc cctatattgg atttcgatac aagacgccaa taaaatattg tacttatata
      361 atagcggaaa agatattgaa cgcgccacta tgacgtcaaa aatttaagtt ttcttacatt
      421 ctttatttta tagccgtctt acaaatgcat tgatgttgta taatatcttc cgctaaaatt
      481 ggtataccca accgaaatat tcaataaaca ttcataaatt tatcactaac attcaatgta
      541 attatttttc ggaaaatata atacgaaatt gaattgtta


LOCUS       AY318796                 621 bp    mRNA    linear   INV 26-SEP-2003
DEFINITION  Mayetiola destructor clone 12g7 salivary secreted protein mRNA,
            complete cds.
ACCESSION   AY318796
VERSION     AY318796
KEYWORDS    .
SOURCE      Mayetiola destructor (Hessian fly)
  ORGANISM  Mayetiola destructor
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea;
            Cecidomyiidae; Mayetiola.
REFERENCE   1  (bases 1 to 621)
  AUTHORS   Chen,M.-S., Fellers,J.P., Stuart,J.J., Reese,J.C., and Liu,X.  TITLE     A group of cDNAs encoding secreted proteins from Hessian fly
            (Mayetiola destructor) salivary glands
  JOURNAL   INSECT MOLECULAR BIOLOGY, IN PRESS
REFERENCE   2  (bases 1 to 621)
  AUTHORS   Chen,M.-S. and Fellers,J.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JUN-2003) Plant Science and Entomology Research unit,
            USDA-ARS, 1515 College Avenue, Manhattan, KS 66502, USA
FEATURES             Location/Qualifiers
     source          1..621
                     /organism="Mayetiola destructor"
                     /mol_type="mRNA"
                     /db_xref="taxon:39758"
                     /clone="12g7"
                     /note="biotype: gp"
     CDS             20..337
                     /codon_start=1
                     /evidence=not_experimental
                     /product="salivary secreted protein"
                     /protein_id="AAQ88256"
                     /translation="MKYSLAFLFVASTAFLMASAAPKRAAQQSAEGLPSAPRTEAQLL
                     NELRLAQNALEGLGRRVPDTDLPTEQEKLADAEQLRAARLRLARARAALNLPILDFDT
                     RRR"
BASE COUNT      198 a    132 c    114 g    177 t
ORIGIN     
        1 gaaaacaaac taaattaaaa tgaagtattc gttagctttc cttttcgtag cttctacagc
       61 ttttttgatg gccagcgctg caccgaaacg cgctgctcag caaagcgctg aagggttgcc
      121 ctctgctcca cgaaccgaag cacagttgct caatgaactg agactggctc aaaatgcact
      181 cgagggactt ggacgccgcg taccggatac cgatctacct acggaacagg agaaattggc
      241 agatgctgaa cagttgcgcg ctgcacgatt gcgccttgcc cgggcacgcg ctgcattgaa
      301 tctccctata ttggatttcg atacaagacg ccgataaaat attgtactta tataatagcg
      361 gaaaagatat tgaacgcgcc actatgacgt caaaaattga agttttctta cactctttat
      421 tttatagccg tcttacaaat gcattgatgt tgtataatat cttccgctaa aattggtata
      481 cccaaccgaa atattcaata aacactcata aatttatcac ttacattcaa tgtaattatt
      541 tttcggaaaa tataatacga aattgaattg ttaacttctg atataaagaa aataaatatt
      601 tttgaatgtt cacacatcaa a


LOCUS       AY318797                 484 bp    mRNA    linear   INV 26-SEP-2003
DEFINITION  Mayetiola destructor clone 18b6 salivary secreted protein mRNA,
            complete cds.
ACCESSION   AY318797
VERSION     AY318797
KEYWORDS    .
SOURCE      Mayetiola destructor (Hessian fly)
  ORGANISM  Mayetiola destructor
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea;
            Cecidomyiidae; Mayetiola.
REFERENCE   1  (bases 1 to 484)
  AUTHORS   Chen,M.-S., Fellers,J.P., Stuart,J.J., Reese,J.C., and Liu,X.
  TITLE     A group of cDNAs encoding secreted proteins from Hessian fly
            (Mayetiola destructor) salivary glands
  JOURNAL   INSECT MOLECULAR BIOLOGY, IN PRESS
REFERENCE   2  (bases 1 to 484)
  AUTHORS   Chen,M.-S. and Fellers,J.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUN-2003) Plant Science and Entomology Research unit,
            USDA-ARS, 1515 College Avenue, Manhattan, KS 66502, USA
FEATURES             Location/Qualifiers
     source          1..484
                     /organism="Mayetiola destructor"
                     /mol_type="mRNA"
                     /db_xref="taxon:39758"
                     /clone="18b6"
                     /note="biotype: gp"
     CDS             11..298
                     /codon_start=1
                     /evidence=not_experimental
                     /product="salivary secreted protein"
                     /protein_id="AAQ88257"
                     /translation="MKYSLAFLFVASTAFLMASAAPKRAAQQSEAQLRNELRLALNAL
                     EGLGRRVPDTDVPTVQERLADAEELRAARLRLARARAALNLPILDFDTRRQ"
BASE COUNT      141 a    108 c     97 g    138 t
ORIGIN      
        1 ctaaattaaa atgaagtatt cgttagcttt ccttttcgta gcttctacag cttttttgat
       61 ggccagcgct gcaccgaaac gcgctgctca gcaaagcgaa gcacagttgc gcaatgaact
      121 gagactggct ttaaatgcac tcgagggact tggacgccgc gtaccggata ccgatgtacc
      181 tacggtacag gagagattgg cagatgctga agagttgcgc gctgcacgat tgcgccttgc
      241 ccgggcacgc gctgcattga atctccctat attggatttc gatacaagac gccaataaaa
      301 tattgtactt atataatagc ggaaaagata ttgaacgcgc cactatgacg tcaaaaattt
      361 aagttttctt acattcttta ttttatagcc gtcttacaaa tgcattgatg ttgtataata
      421 tcttccgcta aaattggtat acccacccga aatattcaat aaccattcat aaatttatcc
      481 caaa


LOCUS       AY318798                 576 bp    mRNA    linear   INV 26-SEP-2003
DEFINITION  Mayetiola destructor clone 14g1 salivary secreted protein mRNA,
            complete cds.
ACCESSION   AY318798
VERSION     AY318798
KEYWORDS    .
SOURCE      Mayetiola destructor (Hessian fly)
  ORGANISM  Mayetiola destructor
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Nematocera; Sciaroidea;
            Cecidomyiidae; Mayetiola.
REFERENCE   1  (bases 1 to 576)
  AUTHORS   Chen,M.-S., Fellers,J.P., Stuart,J.J., Reese,J.C., and Liu,X. 
  TITLE     A group of cDNAs encoding secreted proteins from Hessian fly
            (Mayetiola destructor) salivary glands
  JOURNAL   INSECT MOLECULAR BIOLOGY, IN PRESS
REFERENCE   2  (bases 1 to 576)
  AUTHORS   Chen,M.-S. and Fellers,J.P.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUN-2003) Plant Science and Entomology Research unit,
            USDA-ARS, 1515 College Avenue, Manhattan, KS 66502, USA
FEATURES             Location/Qualifiers
     source          1..576
                     /organism="Mayetiola destructor"
                     /mol_type="mRNA"
                     /db_xref="taxon:39758"
                     /clone="14g1"
                     /note="biotype: gp"
     CDS             48..383
                     /codon_start=1
                     /evidence=not_experimental
                     /product="salivary secreted protein"
                     /protein_id="AAQ88258"
                     /translation="MKYSLAFLFVASTAFLMASAAPKRAAQQSGEGSHVEGLRQDLAN
                     INLESSAPRTEAQLRNELRLAQHALDVLGRRVPDLNLSQHEKLADAEQLRKAKERVER
                     ASAALNRAR"
BASE COUNT      178 a    127 c    115 g    156 t
ORIGIN     
        1 atcagttttg aatgaacttt gttctagaga aaacaaacta aattaaaatg aagtattcgt
       61 tagctttcct tttcgtagct tctacagctt ttttaatggc cagcgctgca ccgaaacgcg
      121 ctgctcagca aagcggtgaa gggtcgcacg ttgaagggtt gcgccaggat ctggcaaaca
      181 ttaaccttga atcctctgct ccacgaaccg aagcacagtt gcgcaatgaa ctgagactcg
      241 ctcaacatgc actcgatgta cttggacgcc gcgtaccgga tctcaatcta tcgcaacacg
      301 agaaattggc agatgctgaa cagttgcgca aagcaaagga acgcgttgag cgggcaagcg
      361 ctgcattgaa tcgcgctaga tgattccaat aaaatattgt acttatataa tagcggaaaa
      421 gatattgaac gcgccactat gacgtccaaa attgaagttt tcttacattc tttattttat
      481 agccgtctta caaatgcatt gatgttgtat aatatcttcc gctaaaattg gtatacccaa
      541 ccgaaatatt caataaacac tcataaattt atcacc